Lineage for d1qwua2 (1qwu A:523-1044)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045015Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 protein domains)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 2045016Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 2045017Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 2045071Domain d1qwua2: 1qwu A:523-1044 [96504]
    Other proteins in same PDB: d1qwua1, d1qwua3
    complexed with gul, mpd, nag, zn; mutant

Details for d1qwua2

PDB Entry: 1qwu (more details), 2.03 Å

PDB Description: Golgi alpha-mannosidase II D341N mutant complex with 5-F-guloside
PDB Compounds: (A:) Alpha-mannosidase II

SCOPe Domain Sequences for d1qwua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwua2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOPe Domain Coordinates for d1qwua2:

Click to download the PDB-style file with coordinates for d1qwua2.
(The format of our PDB-style files is described here.)

Timeline for d1qwua2: