Lineage for d1qwtb_ (1qwt B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371023Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 371024Superfamily b.26.1: SMAD/FHA domain [49879] (3 families) (S)
    has a few short helices inserted in loops
  5. 371095Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
    weak sequence similarity to SMAD domain
  6. 371096Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)
  7. 371097Species Human (Homo sapiens) [TaxId:9606] [101632] (2 PDB entries)
  8. 371099Domain d1qwtb_: 1qwt B: [96502]
    complexed with po4

Details for d1qwtb_

PDB Entry: 1qwt (more details), 2.1 Å

PDB Description: Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain

SCOP Domain Sequences for d1qwtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwtb_ b.26.1.3 (B:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens)}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges

SCOP Domain Coordinates for d1qwtb_:

Click to download the PDB-style file with coordinates for d1qwtb_.
(The format of our PDB-style files is described here.)

Timeline for d1qwtb_: