![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
![]() | Superfamily b.26.1: SMAD/FHA domain [49879] (3 families) ![]() has a few short helices inserted in loops |
![]() | Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein) weak sequence similarity to SMAD domain |
![]() | Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101632] (2 PDB entries) |
![]() | Domain d1qwtb_: 1qwt B: [96502] complexed with po4 |
PDB Entry: 1qwt (more details), 2.1 Å
SCOP Domain Sequences for d1qwtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwtb_ b.26.1.3 (B:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens)} enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges
Timeline for d1qwtb_: