SCOPe 2.07: Domain d1qwta_: 1qwt A:

Lineage for d1qwta_ (1qwt A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
   weak sequence similarity to SMAD domain

6. Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)

8. Domain d1qwta_: 1qwt A: [96501]
   complexed with po4

Details for d1qwta_

PDB Entry: 1qwt, 2.1 Å

PDB Description: Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain

PDB Compounds: (A:) Interferon regulatory factor 3

SCOPe Domain Sequences for d1qwta_:

Sequence; same for both SEQRES and ATOM records:

>d1qwta_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges

Timeline for d1qwta_:

• d1qwta_ first appeared in SCOP 1.67
  
• d1qwta_ appears in SCOPe 2.06
  
• d1qwta_ appears in the current release, SCOPe 2.08