Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.3: Type I phosphomannose isomerase [51191] (3 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
Protein Mannose-6-phosphate isomerase ManA [101987] (1 species) |
Species Bacillus subtilis [TaxId:1423] [101988] (1 PDB entry) |
Domain d1qwrb_: 1qwr B: [96492] complexed with act, fmt, so4, zn |
PDB Entry: 1qwr (more details), 1.8 Å
SCOPe Domain Sequences for d1qwrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwrb_ b.82.1.3 (B:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} qspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktli elweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyiid ckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalckgalvl etqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgitiktf vqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilpaqmpd ftikgtctlivshi
Timeline for d1qwrb_: