SCOPe 2.07: Domain d1qwra_: 1qwr A:

Lineage for d1qwra_ (1qwr A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.3: Type I phosphomannose isomerase [51191] (4 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein Mannose-6-phosphate isomerase ManA [101987] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101988] (1 PDB entry)

8. Domain d1qwra_: 1qwr A: [96491]
   complexed with act, fmt, so4, zn

Details for d1qwra_

PDB Entry: 1qwr, 1.8 Å

PDB Description: Crystal Structure Analysis of the Mannose 6-Phosphate Isomerase from Bacillus subtilis

PDB Compounds: (A:) Mannose-6-phosphate isomerase

SCOPe Domain Sequences for d1qwra_:

Sequence; same for both SEQRES and ATOM records:

>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]}
tqspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktl
ielweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyii
dckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalckgalv
letqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgitikt
fvqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilpaqmp
dftikgtctlivshi

Timeline for d1qwra_:

• d1qwra_ first appeared in SCOP 1.67
  
• d1qwra_ appears in SCOPe 2.06
  
• d1qwra_ appears in the current release, SCOPe 2.08