Lineage for d1qwra_ (1qwr A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381160Superfamily b.82.1: RmlC-like cupins [51182] (12 families) (S)
  5. 381281Family b.82.1.3: Type I phosphomannose isomerase [51191] (2 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 381282Protein Mannose-6-phosphate isomerase ManA [101987] (1 species)
  7. 381283Species Bacillus subtilis [TaxId:1423] [101988] (1 PDB entry)
  8. 381284Domain d1qwra_: 1qwr A: [96491]

Details for d1qwra_

PDB Entry: 1qwr (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of the Mannose 6-Phosphate Isomerase from Bacillus subtilis

SCOP Domain Sequences for d1qwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis}
tqspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktl
ielweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyii
dckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalckgalv
letqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgitikt
fvqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilpaqmp
dftikgtctlivshi

SCOP Domain Coordinates for d1qwra_:

Click to download the PDB-style file with coordinates for d1qwra_.
(The format of our PDB-style files is described here.)

Timeline for d1qwra_: