![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (12 families) ![]() |
![]() | Family b.82.1.3: Type I phosphomannose isomerase [51191] (2 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
![]() | Protein Mannose-6-phosphate isomerase ManA [101987] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101988] (1 PDB entry) |
![]() | Domain d1qwra_: 1qwr A: [96491] |
PDB Entry: 1qwr (more details), 1.8 Å
SCOP Domain Sequences for d1qwra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis} tqspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktl ielweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyii dckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalckgalv letqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgitikt fvqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilpaqmp dftikgtctlivshi
Timeline for d1qwra_: