Lineage for d1qwqa_ (1qwq A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890411Protein Seminal ribonucleasease [54086] (1 species)
  7. 1890412Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries)
    Uniprot P00669 27-150
  8. 1890444Domain d1qwqa_: 1qwq A: [96490]
    mutant

Details for d1qwqa_

PDB Entry: 1qwq (more details)

PDB Description: solution structure of the monomeric n67d mutant of bovine seminal ribonuclease
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d1qwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwqa_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOPe Domain Coordinates for d1qwqa_:

Click to download the PDB-style file with coordinates for d1qwqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qwqa_: