SCOP 1.67: Domain d1qwna2: 1qwn A:523-1044

Lineage for d1qwna2 (1qwn A:523-1044)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
   the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains

6. Protein Golgi alpha-mannosidase II [88657] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (7 PDB entries)

8. Domain d1qwna2: 1qwn A:523-1044 [96488]
   Other proteins in same PDB: d1qwna1, d1qwna3
   complexed with gul, mpd, nag, trs, zn

Details for d1qwna2

PDB Entry: 1qwn, 1.2 Å

PDB Description: golgi alpha-mannosidase ii covalent intermediate complex with 5- fluoro-gulosyl-fluoride

SCOP Domain Sequences for d1qwna2:

Sequence; same for both SEQRES and ATOM records:

>d1qwna2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster)}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

Timeline for d1qwna2:

• d1qwna2 is new in SCOP 1.67
  
• d1qwna2 appears in SCOP 1.69
  
• d1qwna2 appears in the current release, SCOPe 2.08