Lineage for d1qwma_ (1qwm A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2620683Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2620684Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2620685Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2620686Protein Catalase I [56636] (8 species)
  7. 2620718Species Helicobacter pylori [TaxId:210] [103392] (4 PDB entries)
  8. 2620721Domain d1qwma_: 1qwm A: [96485]
    complexed with azi, fmt, hem

Details for d1qwma_

PDB Entry: 1qwm (more details), 1.6 Å

PDB Description: Structure of Helicobacter pylori catalase with formic acid bound
PDB Compounds: (A:) KatA Catalase

SCOPe Domain Sequences for d1qwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwma_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]}
mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
kalekhqkmm

SCOPe Domain Coordinates for d1qwma_:

Click to download the PDB-style file with coordinates for d1qwma_.
(The format of our PDB-style files is described here.)

Timeline for d1qwma_: