Lineage for d1qwka_ (1qwk A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1817578Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1817790Protein Hypothetical protein C07D8.6 [102049] (1 species)
    Aldo-keto reductase family 1 member c1
  7. 1817791Species Nematode (Caenorhabditis elegans) [TaxId:6239] [102050] (1 PDB entry)
  8. 1817792Domain d1qwka_: 1qwk A: [96482]
    structural genomics

Details for d1qwka_

PDB Entry: 1qwk (more details), 1.6 Å

PDB Description: structural genomics of caenorhabditis elegans: hypothetical 35.2 kda protein (aldose reductase family member)
PDB Compounds: (A:) Aldo-keto reductase family 1 member C1

SCOPe Domain Sequences for d1qwka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
tasiklsngvempviglgtwqsspaevitavktavkagyrlidtasvyqneeaigtaike
lleegvvkreelfittkawthelapgklegglreslkklqleyvdlylahmpaafnddms
ehiaspvedvwrqfdavykaglakavgvsnwnndqisralalgltpvhnsqvelhlyfpq
hdhvdfckkhnisvtsyatlgspgrvnftlptgqkldwapapsdlqdqnvlalaekthkt
paqvllryaldrgcailpksiqenrikenfevfdfslteediakleesknsqrlflqdfm
tghpedafaaer

SCOPe Domain Coordinates for d1qwka_:

Click to download the PDB-style file with coordinates for d1qwka_.
(The format of our PDB-style files is described here.)

Timeline for d1qwka_: