Lineage for d1qwga_ (1qwg A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 387021Superfamily c.1.27: (2r)-phospho-3-sulfolactate synthase ComA [102110] (1 family) (S)
  5. 387022Family c.1.27.1: (2r)-phospho-3-sulfolactate synthase ComA [102111] (1 protein)
  6. 387023Protein (2r)-phospho-3-sulfolactate synthase ComA [102112] (1 species)
  7. 387024Species Archaeon Methanococcus jannaschii [TaxId:2190] [102113] (1 PDB entry)
  8. 387025Domain d1qwga_: 1qwg A: [96473]
    complexed with so4

Details for d1qwga_

PDB Entry: 1qwg (more details), 1.6 Å

PDB Description: crystal structure of methanococcus jannaschii phosphosulfolactate synthase

SCOP Domain Sequences for d1qwga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii}
mkafeflyedfqrgltvvldkglppkfvedylkvcgdyidfvkfgwgtsavidrdvvkek
inyykdwgikvypggtlfeyayskgkfdeflneceklgfeaveisdgssdisleernnai
krakdngfmvltevgkkmpdkdkqltiddriklinfdldagadyviiegresgkgkglfd
kegkvkeneldvlaknvdinkvifeapqksqqvafilkfgssvnlaniafdevisletlr
rglrgdtfgkv

SCOP Domain Coordinates for d1qwga_:

Click to download the PDB-style file with coordinates for d1qwga_.
(The format of our PDB-style files is described here.)

Timeline for d1qwga_: