Lineage for d1qwga_ (1qwg A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.27: (2r)-phospho-3-sulfolactate synthase ComA [102110] (1 family) (S)
    automatically mapped to Pfam PF02679
  5. Family c.1.27.1: (2r)-phospho-3-sulfolactate synthase ComA [102111] (1 protein)
  6. Protein (2r)-phospho-3-sulfolactate synthase ComA [102112] (2 species)
  7. Species Methanococcus jannaschii [TaxId:2190] [102113] (1 PDB entry)
  8. Domain d1qwga_: 1qwg A: [96473]
    complexed with so4

Details for d1qwga_

PDB Entry: 1qwg (more details), 1.6 Å

PDB Description: crystal structure of methanococcus jannaschii phosphosulfolactate synthase
PDB Compounds: (A:) (2R)-phospho-3-sulfolactate synthase

SCOPe Domain Sequences for d1qwga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Methanococcus jannaschii [TaxId: 2190]}
mkafeflyedfqrgltvvldkglppkfvedylkvcgdyidfvkfgwgtsavidrdvvkek
inyykdwgikvypggtlfeyayskgkfdeflneceklgfeaveisdgssdisleernnai
krakdngfmvltevgkkmpdkdkqltiddriklinfdldagadyviiegresgkgkglfd
kegkvkeneldvlaknvdinkvifeapqksqqvafilkfgssvnlaniafdevisletlr
rglrgdtfgkv

SCOPe Domain Coordinates for d1qwga_ are not available.

Timeline for d1qwga_: