SCOPe 2.04: Domain d1qwca_: 1qwc A:

Lineage for d1qwca_ (1qwc A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (169 PDB entries)
   Uniprot P29476 298-716

8. Domain d1qwca_: 1qwc A: [96470]
   complexed with 14w, h4b, hem, zn

Details for d1qwca_

PDB Entry: 1qwc, 2.3 Å

PDB Description: rat neuronal nitric oxide synthase oxygenase domain in complex with w1400 inhibitor.

PDB Compounds: (A:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1qwca_:

Sequence; same for both SEQRES and ATOM records:

>d1qwca_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gprflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfp
lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
dycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Timeline for d1qwca_:

• d1qwca_ first appeared in SCOP 1.67
  
• d1qwca_ appears in SCOPe 2.03
  
• d1qwca_ appears in SCOPe 2.05
  
• d1qwca_ appears in the current release, SCOPe 2.08, called d1qwca1