SCOPe 2.08: Domain d1qwca1: 1qwc A:298-716

Lineage for d1qwca1 (1qwc A:298-716)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (277 PDB entries)
   Uniprot P29476 298-716

8. Domain d1qwca1: 1qwc A:298-716 [96470]
   Other proteins in same PDB: d1qwca2
   complexed with 14w, h4b, hem, zn

Details for d1qwca1

PDB Entry: 1qwc, 2.3 Å

PDB Description: rat neuronal nitric oxide synthase oxygenase domain in complex with w1400 inhibitor.

PDB Compounds: (A:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1qwca1:

Sequence; same for both SEQRES and ATOM records:

>d1qwca1 d.174.1.1 (A:298-716) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
prflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpl
akefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvg
riqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwns
qliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqip
pelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrd
ycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsates
fikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Timeline for d1qwca1:

• d1qwca1 first appeared in SCOP 1.67, called d1qwca_
  
• d1qwca1 appears in SCOPe 2.07