Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species) glycosyl hydrolase family 51 |
Species Bacillus stearothermophilus [TaxId:1422] [102076] (4 PDB entries) |
Domain d1qw9a2: 1qw9 A:18-384 [96467] Other proteins in same PDB: d1qw9a1, d1qw9b1 complexed with khp |
PDB Entry: 1qw9 (more details), 1.2 Å
SCOPe Domain Sequences for d1qw9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} eidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelqvpiirypggnfvs gynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevnmavnlgtrgidaa rnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpwqighktaveygriacea akvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislhqyygnrdndtany lalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsneadkliepwtvappl lediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekngpawkqtiyypfm hasvygr
Timeline for d1qw9a2: