Lineage for d1qw8a2 (1qw8 A:18-384)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439246Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species)
    glycosyl hydrolase family 51
  7. 2439247Species Bacillus stearothermophilus [TaxId:1422] [102076] (5 PDB entries)
  8. 2439252Domain d1qw8a2: 1qw8 A:18-384 [96463]
    Other proteins in same PDB: d1qw8a1, d1qw8b1
    complexed with kho

Details for d1qw8a2

PDB Entry: 1qw8 (more details), 1.8 Å

PDB Description: crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl
PDB Compounds: (A:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d1qw8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qw8a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
eidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelqvpiirypggnfvs
gynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevnmavnlgtrgidaa
rnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpwqighktaveygriacea
akvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislhqyygnrdndtany
lalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsneadkliepwtvappl
lediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekngpawkqtiyypfm
hasvygr

SCOPe Domain Coordinates for d1qw8a2:

Click to download the PDB-style file with coordinates for d1qw8a2.
(The format of our PDB-style files is described here.)

Timeline for d1qw8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qw8a1