Lineage for d1qw2a1 (1qw2 A:20-114)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240985Fold d.249: Hypothetical protein Ta1206 [102890] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha(2); mixed, predominately antiparallel beta-sheet, order: 123465, strands 4 and 5 are parallel to each other
  4. 2240986Superfamily d.249.1: Hypothetical protein Ta1206 [102891] (1 family) (S)
    can be divided into an N-terminal, tetramerisation all-beta subdomain and a C-terminal alpha+beta subdomain related by a circular permutation to the Y-family DNA-polymerase 'fingers' subdomain
  5. 2240987Family d.249.1.1: Hypothetical protein Ta1206 [102892] (1 protein)
  6. 2240988Protein Hypothetical protein Ta1206 [102893] (1 species)
  7. 2240989Species Thermoplasma acidophilum [TaxId:2303] [102894] (1 PDB entry)
  8. 2240990Domain d1qw2a1: 1qw2 A:20-114 [96456]
    Other proteins in same PDB: d1qw2a2, d1qw2a3
    structural genomics

Details for d1qw2a1

PDB Entry: 1qw2 (more details), 1.5 Å

PDB Description: Crystal Structure of a Protein of Unknown Function TA1206 from Thermoplasma acidophilum
PDB Compounds: (A:) conserved hypothetical protein TA1206

SCOPe Domain Sequences for d1qw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qw2a1 d.249.1.1 (A:20-114) Hypothetical protein Ta1206 {Thermoplasma acidophilum [TaxId: 2303]}
mmqidsieiggkvyqffksdlgnapllfikgskgyamcgylnmetsnkvgdiavrvmgvk
tlddmlsakvveasqeaqkvginpgdvlrnvidkl

SCOPe Domain Coordinates for d1qw2a1:

Click to download the PDB-style file with coordinates for d1qw2a1.
(The format of our PDB-style files is described here.)

Timeline for d1qw2a1: