Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.249: Hypothetical protein Ta1206 [102890] (1 superfamily) beta(4)-alpha-beta(2)-alpha(2); mixed, predominately antiparallel beta-sheet, order: 123465, strands 4 and 5 are parallel to each other |
Superfamily d.249.1: Hypothetical protein Ta1206 [102891] (1 family) can be divided into an N-terminal, tetramerisation all-beta subdomain and a C-terminal alpha+beta subdomain related by a circular permutation to the Y-family DNA-polymerase 'fingers' subdomain |
Family d.249.1.1: Hypothetical protein Ta1206 [102892] (1 protein) |
Protein Hypothetical protein Ta1206 [102893] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [102894] (1 PDB entry) |
Domain d1qw2a_: 1qw2 A: [96456] structural genomics |
PDB Entry: 1qw2 (more details), 1.5 Å
SCOPe Domain Sequences for d1qw2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qw2a_ d.249.1.1 (A:) Hypothetical protein Ta1206 {Thermoplasma acidophilum [TaxId: 2303]} nyfqghmmqidsieiggkvyqffksdlgnapllfikgskgyamcgylnmetsnkvgdiav rvmgvktlddmlsakvveasqeaqkvginpgdvlrnvidklg
Timeline for d1qw2a_: