SCOPe 2.04: Domain d1qw2a_: 1qw2 A:

Lineage for d1qw2a_ (1qw2 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.249: Hypothetical protein Ta1206 [102890] (1 superfamily)
   beta(4)-alpha-beta(2)-alpha(2); mixed, predominately antiparallel beta-sheet, order: 123465, strands 4 and 5 are parallel to each other

4. Superfamily d.249.1: Hypothetical protein Ta1206 [102891] (1 family)
   can be divided into an N-terminal, tetramerisation all-beta subdomain and a C-terminal alpha+beta subdomain related by a circular permutation to the Y-family DNA-polymerase 'fingers' subdomain

5. Family d.249.1.1: Hypothetical protein Ta1206 [102892] (1 protein)

6. Protein Hypothetical protein Ta1206 [102893] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [102894] (1 PDB entry)

8. Domain d1qw2a_: 1qw2 A: [96456]
   structural genomics

Details for d1qw2a_

PDB Entry: 1qw2, 1.5 Å

PDB Description: Crystal Structure of a Protein of Unknown Function TA1206 from Thermoplasma acidophilum

PDB Compounds: (A:) conserved hypothetical protein TA1206

SCOPe Domain Sequences for d1qw2a_:

Sequence; same for both SEQRES and ATOM records:

>d1qw2a_ d.249.1.1 (A:) Hypothetical protein Ta1206 {Thermoplasma acidophilum [TaxId: 2303]}
nyfqghmmqidsieiggkvyqffksdlgnapllfikgskgyamcgylnmetsnkvgdiav
rvmgvktlddmlsakvveasqeaqkvginpgdvlrnvidklg

Timeline for d1qw2a_:

• d1qw2a_ first appeared in SCOP 1.67
  
• d1qw2a_ appears in SCOPe 2.03
  
• d1qw2a_ appears in SCOPe 2.05
  
• d1qw2a_ appears in the current release, SCOPe 2.08, called d1qw2a1