Lineage for d1qw2a_ (1qw2 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516709Fold d.249: Hypothetical protein Ta1206 [102890] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha(2); mixed, predominately antiparallel beta-sheet, order: 123465, strands 4 and 5 are parallel to each other
  4. 516710Superfamily d.249.1: Hypothetical protein Ta1206 [102891] (1 family) (S)
    can be divided into an N-terminal, tetramerisation all-beta subdomain and a C-terminal alpha+beta subdomain related by a circular permutation to the Y-family DNA-polymerase 'fingers' subdomain
  5. 516711Family d.249.1.1: Hypothetical protein Ta1206 [102892] (1 protein)
  6. 516712Protein Hypothetical protein Ta1206 [102893] (1 species)
  7. 516713Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102894] (1 PDB entry)
  8. 516714Domain d1qw2a_: 1qw2 A: [96456]
    structural genomics

Details for d1qw2a_

PDB Entry: 1qw2 (more details), 1.5 Å

PDB Description: Crystal Structure of a Protein of Unknown Function TA1206 from Thermoplasma acidophilum

SCOP Domain Sequences for d1qw2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qw2a_ d.249.1.1 (A:) Hypothetical protein Ta1206 {Archaeon Thermoplasma acidophilum}
nyfqghmmqidsieiggkvyqffksdlgnapllfikgskgyamcgylnmetsnkvgdiav
rvmgvktlddmlsakvveasqeaqkvginpgdvlrnvidklg

SCOP Domain Coordinates for d1qw2a_:

Click to download the PDB-style file with coordinates for d1qw2a_.
(The format of our PDB-style files is described here.)

Timeline for d1qw2a_: