SCOPe 2.08: Domain d1qw2a1: 1qw2 A:20-114

Lineage for d1qw2a1 (1qw2 A:20-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.249: Hypothetical protein Ta1206 [102890] (1 superfamily)
   beta(4)-alpha-beta(2)-alpha(2); mixed, predominately antiparallel beta-sheet, order: 123465, strands 4 and 5 are parallel to each other

4. Superfamily d.249.1: Hypothetical protein Ta1206 [102891] (1 family)
   can be divided into an N-terminal, tetramerisation all-beta subdomain and a C-terminal alpha+beta subdomain related by a circular permutation to the Y-family DNA-polymerase 'fingers' subdomain

5. Family d.249.1.1: Hypothetical protein Ta1206 [102892] (1 protein)

6. Protein Hypothetical protein Ta1206 [102893] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [102894] (1 PDB entry)

8. Domain d1qw2a1: 1qw2 A:20-114 [96456]
   Other proteins in same PDB: d1qw2a2, d1qw2a3
   structural genomics

Details for d1qw2a1

PDB Entry: 1qw2, 1.5 Å

PDB Description: Crystal Structure of a Protein of Unknown Function TA1206 from Thermoplasma acidophilum

PDB Compounds: (A:) conserved hypothetical protein TA1206

SCOPe Domain Sequences for d1qw2a1:

Sequence; same for both SEQRES and ATOM records:

>d1qw2a1 d.249.1.1 (A:20-114) Hypothetical protein Ta1206 {Thermoplasma acidophilum [TaxId: 2303]}
mmqidsieiggkvyqffksdlgnapllfikgskgyamcgylnmetsnkvgdiavrvmgvk
tlddmlsakvveasqeaqkvginpgdvlrnvidkl

Timeline for d1qw2a1:

• d1qw2a1 first appeared in SCOP 1.67, called d1qw2a_
  
• d1qw2a1 appears in SCOPe 2.07