SCOP 1.73: Domain d1qvyd_: 1qvy D:

Lineage for d1qvyd_ (1qvy D:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries)

8. Domain d1qvyd_: 1qvy D: [96452]
   complexed with so4; mutant

Details for d1qvyd_

PDB Entry: 1qvy, 1.6 Å

PDB Description: crystal structure of rhogdi k(199,200)r double mutant

PDB Compounds: (D:) rho GDP-dissociation inhibitor 1

SCOP Domain Sequences for d1qvyd_:

Sequence; same for both SEQRES and ATOM records:

>d1qvyd_ b.1.18.8 (D:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltirrdwkd

Timeline for d1qvyd_:

• d1qvyd_ first appeared in SCOP 1.67
  
• d1qvyd_ appears in SCOP 1.71
  
• d1qvyd_ appears in SCOP 1.75
  
• d1qvyd_ appears in the current release, SCOPe 2.08