Lineage for d1qvyb_ (1qvy B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552337Family b.1.18.8: RhoGDI-like [81288] (2 proteins)
  6. 552343Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 552344Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries)
  8. 552346Domain d1qvyb_: 1qvy B: [96450]

Details for d1qvyb_

PDB Entry: 1qvy (more details), 1.6 Å

PDB Description: crystal structure of rhogdi k(199,200)r double mutant

SCOP Domain Sequences for d1qvyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvyb_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus)}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltirrdwkd

SCOP Domain Coordinates for d1qvyb_:

Click to download the PDB-style file with coordinates for d1qvyb_.
(The format of our PDB-style files is described here.)

Timeline for d1qvyb_: