Lineage for d1qvxa_ (1qvx A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313764Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 2313765Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
    automatically mapped to Pfam PF03623
  6. 2313766Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 2313767Species Chicken (Gallus gallus) [TaxId:9031] [81735] (3 PDB entries)
    Uniprot Q00944 RE 920-1053
  8. 2313769Domain d1qvxa_: 1qvx A: [96448]

Details for d1qvxa_

PDB Entry: 1qvx (more details)

PDB Description: solution structure of the fat domain of focal adhesion kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1qvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvxa_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Chicken (Gallus gallus) [TaxId: 9031]}
rsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslpvlpas
threiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdaknlldvi
dqarlkmisqsrph

SCOPe Domain Coordinates for d1qvxa_:

Click to download the PDB-style file with coordinates for d1qvxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qvxa_: