Lineage for d1qvxa_ (1qvx A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353428Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 353715Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (1 family) (S)
  5. 353716Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (1 protein)
  6. 353717Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 353718Species Chicken (Gallus gallus) [TaxId:9031] [81735] (2 PDB entries)
  8. 353720Domain d1qvxa_: 1qvx A: [96448]

Details for d1qvxa_

PDB Entry: 1qvx (more details)

PDB Description: solution structure of the fat domain of focal adhesion kinase

SCOP Domain Sequences for d1qvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvxa_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Chicken (Gallus gallus)}
rsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslpvlpas
threiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdaknlldvi
dqarlkmisqsrph

SCOP Domain Coordinates for d1qvxa_:

Click to download the PDB-style file with coordinates for d1qvxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qvxa_: