| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
| Protein Hypothetical protein Ydr533Cp [102253] (1 species) contains a buried Cys-His-Glu triad within one subunit |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102254] (4 PDB entries) |
| Domain d1qvwb_: 1qvw B: [96447] structural genomics complexed with gol |
PDB Entry: 1qvw (more details), 1.9 Å
SCOPe Domain Sequences for d1qvwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvwb_ c.23.16.2 (B:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apkkvllaltsyndvfysdgmktgvfvvealhpfntfrkegfevdfvsetgkfgwdehsl
akdflngqdetdfknkdsdfnktlakiktpkevnaddyqifmasaghgtlfdypkakdlq
diaseiyanggvvaavchgpamfdgltdkktgrpliegksitgftdvgetimgvdsilka
knlatvedvakkygakylapvgpwddysitdgrlvtgvnpasahstavrsidalkn
Timeline for d1qvwb_: