SCOP 1.67: Domain d1qvwb_: 1qvw B:

Lineage for d1qvwb_ (1qvw B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (6 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein Hypothetical protein Ydr533Cp [102253] (1 species)
   contains a buried Cys-His-Glu triad within one subunit

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102254] (4 PDB entries)

8. Domain d1qvwb_: 1qvw B: [96447]
   structural genomics
   complexed with gol; mutant

Details for d1qvwb_

PDB Entry: 1qvw, 1.9 Å

PDB Description: crystal structure of the s. cerevisiae ydr533c protein

SCOP Domain Sequences for d1qvwb_:

Sequence; same for both SEQRES and ATOM records:

>d1qvwb_ c.23.16.2 (B:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae)}
apkkvllaltsyndvfysdgmktgvfvvealhpfntfrkegfevdfvsetgkfgwdehsl
akdflngqdetdfknkdsdfnktlakiktpkevnaddyqifmasaghgtlfdypkakdlq
diaseiyanggvvaavchgpamfdgltdkktgrpliegksitgftdvgetimgvdsilka
knlatvedvakkygakylapvgpwddysitdgrlvtgvnpasahstavrsidalkn

Timeline for d1qvwb_:

• d1qvwb_ is new in SCOP 1.67
  
• d1qvwb_ appears in SCOP 1.69
  
• d1qvwb_ appears in the current release, SCOPe 2.08