Lineage for d1qvrc2 (1qvr C:149-535)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113522Protein ClpB, AAA+ modules [75211] (2 species)
    ATPase subunit of ATP-dependent protease; similar domain organization to ClpA
  7. 2113525Species Thermus thermophilus [TaxId:274] [102395] (1 PDB entry)
  8. 2113530Domain d1qvrc2: 1qvr C:149-535 [96439]
    Other proteins in same PDB: d1qvra1, d1qvrb1, d1qvrc1
    complexed with anp, pt

Details for d1qvrc2

PDB Entry: 1qvr (more details), 3 Å

PDB Description: Crystal Structure Analysis of ClpB
PDB Compounds: (C:) clpb protein

SCOPe Domain Sequences for d1qvrc2:

Sequence, based on SEQRES records: (download)

>d1qvrc2 c.37.1.20 (C:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}
tynaleqygidltrlaaegkldpvigrdeeirrviqillrrtknnpvligepgvgktaiv
eglaqrivkgdvpeglkgkrivslqmgsllagakyrgefeerlkaviqevvqsqgevilf
idelhtvvgagkaegavdagnmlkpalargelrligattldeyreiekdpalerrfqpvy
vdeptveetisilrglkekyevhhgvrisdsaiiaaatlshryiterrlpdkaidlidea
aarlrmalesapeeidalerkklqleierealkkekdpdsqerlkaieaeiaklteeiak
lraewerereilrklreaqhrldevrreielaerqydlnraaelrygelpkleaeveals
eklrgarfvrlevteediaeivsrwtg

Sequence, based on observed residues (ATOM records): (download)

>d1qvrc2 c.37.1.20 (C:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}
tynaleqygidltrlaaegkldpvigrdeeirrviqillrrtknnpvligepgvgktaiv
eglaqrivkgdvpeglkgkrivslqmefeerlkaviqevvqsqgevilfidelkpalarg
elrligattldeyreiekdpalerrfqpvyvdeptveetisilrglkekyevhhgvrisd
saiiaaatlshryiterrlpdkaidlideaaarlrmalesapeeidalerkklqleiere
alkkekdpdsqerlkaieaeiaklteeiaklraewerereilrklreaqhrldevrreie
laerqydlnraaelrygelpkleaevealseklrgarfvrlevteediaeivsrwtg

SCOPe Domain Coordinates for d1qvrc2:

Click to download the PDB-style file with coordinates for d1qvrc2.
(The format of our PDB-style files is described here.)

Timeline for d1qvrc2: