Lineage for d1qvrb3 (1qvr B:536-850)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394970Family c.37.1.20: Extended AAA-ATPase domain [81269] (18 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 394996Protein ClpB, AAA+ modules [75211] (2 species)
    ATPase subunit of ATP-dependent protease; similar domain organization to ClpA
  7. 394999Species Thermus thermophilus [TaxId:274] [102395] (1 PDB entry)
  8. 395003Domain d1qvrb3: 1qvr B:536-850 [96437]
    Other proteins in same PDB: d1qvra1, d1qvrb1, d1qvrc1

Details for d1qvrb3

PDB Entry: 1qvr (more details), 3 Å

PDB Description: Crystal Structure Analysis of ClpB

SCOP Domain Sequences for d1qvrb3:

Sequence, based on SEQRES records: (download)

>d1qvrb3 c.37.1.20 (B:536-850) ClpB, AAA+ modules {Thermus thermophilus}
ipvskllegerekllrleeelhkrvvgqdeairavadairraraglkdpnrpigsflflg
ptgvgktelaktlaatlfdteeamiridmteymekhavsrligappgyvgyeeggqltea
vrrrpysvilfdeiekahpdvfnillqilddgrltdshgrtvdfrntviiltsnlgspli
leglqkgwpyerirdevfkvlqqhfrpeflnrldeivvfrpltkeqirqiveiqlsylra
rlaekrislelteaakdflaergydpvfgarplrrviqreletplaqkilagevkegdrv
qvdvgpaglvfavpa

Sequence, based on observed residues (ATOM records): (download)

>d1qvrb3 c.37.1.20 (B:536-850) ClpB, AAA+ modules {Thermus thermophilus}
ipvskllegerekllrleeelhkrvvgqdeairavadairraraglkdpnrpigsflflg
ptgvgktelaktlaatlfdteeamiridmteymekhavsrlqlteavrrrpysvilfdei
ekahpdvfnillqilddgrltdshgrtvdfrntviiltsnlgsplileglqkgwpyerir
devfkvlqqhfrpeflnrldeivvfrpltkeqirqiveiqlsylrarlaekrisleltea
akdflaergydpvfgarplrrviqreletplaqkilagevkegdrvqvdvgpaglvfavp
a

SCOP Domain Coordinates for d1qvrb3:

Click to download the PDB-style file with coordinates for d1qvrb3.
(The format of our PDB-style files is described here.)

Timeline for d1qvrb3: