Lineage for d1qvra1 (1qvr A:4-148)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348896Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 2348897Superfamily a.174.1: Double Clp-N motif [81923] (2 families) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 2348898Family a.174.1.1: Double Clp-N motif [81924] (3 proteins)
  6. 2348899Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species)
  7. 2348905Species Thermus thermophilus [TaxId:274] [101471] (1 PDB entry)
  8. 2348906Domain d1qvra1: 1qvr A:4-148 [96432]
    Other proteins in same PDB: d1qvra2, d1qvra3, d1qvrb2, d1qvrb3, d1qvrc2, d1qvrc3
    complexed with anp, pt

Details for d1qvra1

PDB Entry: 1qvr (more details), 3 Å

PDB Description: Crystal Structure Analysis of ClpB
PDB Compounds: (A:) clpb protein

SCOPe Domain Sequences for d1qvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]}
erwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkalkel
qerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatpglp
glealkgalkelrggrtvqtehaes

SCOPe Domain Coordinates for d1qvra1:

Click to download the PDB-style file with coordinates for d1qvra1.
(The format of our PDB-style files is described here.)

Timeline for d1qvra1: