Class a: All alpha proteins [46456] (226 folds) |
Fold a.174: Double Clp-N motif [81922] (1 superfamily) multihelical; array |
Superfamily a.174.1: Double Clp-N motif [81923] (1 family) duplication: contains two structural repeats of 4-helical motif |
Family a.174.1.1: Double Clp-N motif [81924] (2 proteins) |
Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species) |
Species Thermus thermophilus [TaxId:274] [101471] (1 PDB entry) |
Domain d1qvra1: 1qvr A:4-148 [96432] Other proteins in same PDB: d1qvra2, d1qvra3, d1qvrb2, d1qvrb3, d1qvrc2, d1qvrc3 |
PDB Entry: 1qvr (more details), 3 Å
SCOP Domain Sequences for d1qvra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus} erwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkalkel qerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatpglp glealkgalkelrggrtvqtehaes
Timeline for d1qvra1: