Lineage for d1qvra1 (1qvr A:4-148)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545680Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 545681Superfamily a.174.1: Double Clp-N motif [81923] (1 family) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 545682Family a.174.1.1: Double Clp-N motif [81924] (2 proteins)
  6. 545683Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species)
  7. 545689Species Thermus thermophilus [TaxId:274] [101471] (1 PDB entry)
  8. 545690Domain d1qvra1: 1qvr A:4-148 [96432]
    Other proteins in same PDB: d1qvra2, d1qvra3, d1qvrb2, d1qvrb3, d1qvrc2, d1qvrc3

Details for d1qvra1

PDB Entry: 1qvr (more details), 3 Å

PDB Description: Crystal Structure Analysis of ClpB

SCOP Domain Sequences for d1qvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus}
erwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkalkel
qerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatpglp
glealkgalkelrggrtvqtehaes

SCOP Domain Coordinates for d1qvra1:

Click to download the PDB-style file with coordinates for d1qvra1.
(The format of our PDB-style files is described here.)

Timeline for d1qvra1: