Lineage for d1qvia1 (1qvi A:29-76)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946622Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 946623Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 946624Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 946625Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
    Uniprot P24733 3-836 ! Uniprot P24733 6-837
  8. 946627Domain d1qvia1: 1qvi A:29-76 [96427]
    Other proteins in same PDB: d1qvia2, d1qviy_, d1qviz_
    complexed with adp, ca, mg, vo4

Details for d1qvia1

PDB Entry: 1qvi (more details), 2.54 Å

PDB Description: Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom resolution: flexibility and function in the head
PDB Compounds: (A:) myosin heavy chain, striated muscle

SCOPe Domain Sequences for d1qvia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvia1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOPe Domain Coordinates for d1qvia1:

Click to download the PDB-style file with coordinates for d1qvia1.
(The format of our PDB-style files is described here.)

Timeline for d1qvia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qvia2