Lineage for d1qvia1 (1qvi A:29-76)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372725Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 372726Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 372727Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 372728Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (9 PDB entries)
  8. 372730Domain d1qvia1: 1qvi A:29-76 [96427]
    Other proteins in same PDB: d1qvia2, d1qviy_, d1qviz_
    complexed with adp, ca, mg, vo4

Details for d1qvia1

PDB Entry: 1qvi (more details), 2.54 Å

PDB Description: Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom resolution: flexibility and function in the head

SCOP Domain Sequences for d1qvia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvia1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOP Domain Coordinates for d1qvia1:

Click to download the PDB-style file with coordinates for d1qvia1.
(The format of our PDB-style files is described here.)

Timeline for d1qvia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qvia2