SCOP 1.73: Domain d1qvgz_: 1qvg Z:

Lineage for d1qvgz_ (1qvg Z:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families)

5. Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)

6. Protein Ribosomal protein L37e [57834] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)

8. Domain d1qvgz_: 1qvg Z: [96418]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_
   complexed with cd, cl, k, mg, na

Details for d1qvgz_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Z:) 50S ribosomal protein L37e

SCOP Domain Sequences for d1qvgz_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgz_ g.41.8.2 (Z:) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

Timeline for d1qvgz_:

• d1qvgz_ first appeared in SCOP 1.67
  
• d1qvgz_ appears in SCOP 1.71
  
• d1qvgz_ appears in SCOP 1.75
  
• d1qvgz_ appears in the current release, SCOPe 2.08