SCOP 1.73: Domain d1qvgx_: 1qvg X:

Lineage for d1qvgx_ (1qvg X:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (40 PDB entries)

8. Domain d1qvgx_: 1qvg X: [96416]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgy_, d1qvgz_
   complexed with cd, cl, k, mg, na

Details for d1qvgx_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (X:) 50S ribosomal protein L32e

SCOP Domain Sequences for d1qvgx_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgx_ c.9.2.1 (X:) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d1qvgx_:

• d1qvgx_ first appeared in SCOP 1.67
  
• d1qvgx_ appears in SCOP 1.71
  
• d1qvgx_ appears in SCOP 1.75
  
• d1qvgx_ appears in the current release, SCOPe 2.08