Lineage for d1qvgx_ (1qvg X:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480097Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 480126Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 480127Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 480128Protein Ribosomal protein L32e [52044] (1 species)
  7. 480129Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (19 PDB entries)
  8. 480144Domain d1qvgx_: 1qvg X: [96416]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgy_, d1qvgz_

Details for d1qvgx_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgx_ c.9.2.1 (X:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1qvgx_:

Click to download the PDB-style file with coordinates for d1qvgx_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgx_: