Lineage for d1qvgw_ (1qvg W:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200379Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 1200380Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 1200381Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 1200382Protein Ribosomal protein L31e [54577] (1 species)
  7. 1200383Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 1200410Domain d1qvgw_: 1qvg W: [96415]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgx_, d1qvgy_, d1qvgz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgw_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (W:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1qvgw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgw_ d.29.1.1 (W:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1qvgw_:

Click to download the PDB-style file with coordinates for d1qvgw_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgw_: