SCOPe 2.05: Domain d1qvgv_: 1qvg V:

Lineage for d1qvgv_ (1qvg V:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
   Uniprot P14121

8. Domain d1qvgv_: 1qvg V: [96414]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgv_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (V:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d1qvgv_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgv_ d.59.1.1 (V:) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d1qvgv_:

• d1qvgv_ first appeared in SCOP 1.67
  
• d1qvgv_ appears in SCOPe 2.04
  
• d1qvgv_ appears in SCOPe 2.06
  
• d1qvgv_ appears in the current release, SCOPe 2.08