Lineage for d1qvgv_ (1qvg V:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912088Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1912089Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1912090Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1912091Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 1912092Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 1912119Domain d1qvgv_: 1qvg V: [96414]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgv_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d1qvgv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgv_ d.59.1.1 (V:) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d1qvgv_:

Click to download the PDB-style file with coordinates for d1qvgv_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgv_: