Lineage for d1qvgu_ (1qvg U:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 531983Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 531989Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 531990Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 531991Protein Ribosomal protein L29 (L29p) [46563] (2 species)
  7. 531992Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (19 PDB entries)
  8. 532007Domain d1qvgu_: 1qvg U: [96413]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvgu_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgu_ a.2.2.1 (U:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1qvgu_:

Click to download the PDB-style file with coordinates for d1qvgu_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgu_: