Lineage for d1qvgt_ (1qvg T:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965443Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
    automatically mapped to Pfam PF01246
  6. 1965444Protein Ribosomal protein L24e [57750] (1 species)
  7. 1965445Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 1965472Domain d1qvgt_: 1qvg T: [96412]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgt_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (T:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d1qvgt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgt_ g.39.1.6 (T:) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1qvgt_:

Click to download the PDB-style file with coordinates for d1qvgt_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgt_: