Lineage for d1qvgp_ (1qvg P:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557707Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 557708Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 557709Protein Ribosomal proteins L21e [50108] (1 species)
  7. 557710Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (19 PDB entries)
  8. 557725Domain d1qvgp_: 1qvg P: [96408]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvgp_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (P:)

SCOP Domain Sequences for d1qvgp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgp_ b.34.5.1 (P:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d1qvgp_:

Click to download the PDB-style file with coordinates for d1qvgp_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgp_: