Lineage for d1qvgo_ (1qvg O:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742039Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 1742040Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 1742041Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 1742042Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 1742043Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 1742085Domain d1qvgo_: 1qvg O: [96407]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgo_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d1qvgo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgo_ a.94.1.1 (O:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1qvgo_:

Click to download the PDB-style file with coordinates for d1qvgo_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgo_: