Lineage for d1qvgo_ (1qvg O:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446210Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 446211Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 446212Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 446213Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 446214Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (19 PDB entries)
  8. 446229Domain d1qvgo_: 1qvg O: [96407]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_

Details for d1qvgo_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgo_ a.94.1.1 (O:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1qvgo_:

Click to download the PDB-style file with coordinates for d1qvgo_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgo_: