Lineage for d1qvgk_ (1qvg K:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1156287Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 1156288Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 1156289Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 1156290Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 1156328Species Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)
    Uniprot P12737
  8. 1156355Domain d1qvgk_: 1qvg K: [96403]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgk_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L15P

SCOPe Domain Sequences for d1qvgk_:

Sequence, based on SEQRES records: (download)

>d1qvgk_ c.12.1.1 (K:) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1qvgk_ c.12.1.1 (K:) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOPe Domain Coordinates for d1qvgk_:

Click to download the PDB-style file with coordinates for d1qvgk_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgk_: