SCOP 1.73: Domain d1qvgj_: 1qvg J:

Lineage for d1qvgj_ (1qvg J:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (3 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (40 PDB entries)

8. Domain d1qvgj_: 1qvg J: [96402]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   complexed with cd, cl, k, mg, na

Details for d1qvgj_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (J:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1qvgj_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgj_ b.39.1.1 (J:) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d1qvgj_:

• d1qvgj_ first appeared in SCOP 1.67
  
• d1qvgj_ appears in SCOP 1.71
  
• d1qvgj_ appears in SCOP 1.75
  
• d1qvgj_ appears in the current release, SCOPe 2.08