Lineage for d1qvgg_ (1qvg G:)

  1. Root: SCOPe 2.03
  2. 1470528Class j: Peptides [58231] (120 folds)
  3. 1472006Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1472007Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1472008Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1472009Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1472010Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1472038Domain d1qvgg_: 1qvg G: [96399]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvgg_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d1qvgg_:

Sequence, based on SEQRES records: (download)

>d1qvgg_ j.84.1.1 (G:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1qvgg_ j.84.1.1 (G:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1qvgg_:

Click to download the PDB-style file with coordinates for d1qvgg_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgg_: