Lineage for d1qvga1 (1qvg A:91-237)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796751Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 796752Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 796753Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
    Uniprot P20276
  8. 796784Domain d1qvga1: 1qvg A:91-237 [96391]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvga1

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1qvga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvga1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1qvga1:

Click to download the PDB-style file with coordinates for d1qvga1.
(The format of our PDB-style files is described here.)

Timeline for d1qvga1: