Lineage for d1qvg1_ (1qvg 1:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099677Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1099678Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 1099679Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 1099680Protein Ribosomal protein L39e [48664] (1 species)
  7. 1099681Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 1099724Domain d1qvg1_: 1qvg 1: [96389]
    Other proteins in same PDB: d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvg1_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1qvg1_:

Sequence, based on SEQRES records: (download)

>d1qvg1_ a.137.1.1 (1:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1qvg1_ a.137.1.1 (1:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOPe Domain Coordinates for d1qvg1_:

Click to download the PDB-style file with coordinates for d1qvg1_.
(The format of our PDB-style files is described here.)

Timeline for d1qvg1_: