Lineage for d1qvg1_ (1qvg 1:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649538Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
    not a true fold
  4. 649539Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 649540Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 649541Protein Ribosomal protein L39e [48664] (1 species)
  7. 649542Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)
  8. 649556Domain d1qvg1_: 1qvg 1: [96389]
    Other proteins in same PDB: d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvg1_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L39e

SCOP Domain Sequences for d1qvg1_:

Sequence, based on SEQRES records: (download)

>d1qvg1_ a.137.1.1 (1:) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1qvg1_ a.137.1.1 (1:) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1qvg1_:

Click to download the PDB-style file with coordinates for d1qvg1_.
(The format of our PDB-style files is described here.)

Timeline for d1qvg1_: