![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
![]() | Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein) |
![]() | Protein Ribosomal protein L37ae [57831] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries) Uniprot P60619 |
![]() | Domain d1qvfy_: 1qvf Y: [96387] Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfz_ protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1qvf (more details), 3.1 Å
SCOPe Domain Sequences for d1qvfy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvfy_ g.41.8.1 (Y:) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]} rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy qpetvagkavmka
Timeline for d1qvfy_:
![]() Domains from other chains: (mouse over for more information) d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfz_ |