Lineage for d1qvfw_ (1qvf W:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410314Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 410315Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 410316Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 410317Protein Ribosomal protein L31e [54577] (1 species)
  7. 410318Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (18 PDB entries)
  8. 410326Domain d1qvfw_: 1qvf W: [96385]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfw_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfw_ d.29.1.1 (W:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1qvfw_:

Click to download the PDB-style file with coordinates for d1qvfw_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfw_: